(data stored in ACNUC7421 zone)

EMBL: CP001622.PE532

CP001622.PE532       Location/Qualifiers
FT   CDS             562653..564374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0540"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000938 probable two-component
FT                   sensor histidine kinase protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: response regulator receiver; PAS fold domain
FT                   protein; PAS fold-4 domain protein; SMART: response
FT                   regulator receiver; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54844"
FT                   /db_xref="GOA:C6B2M4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M4"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACS54844.1"
FT                   /translation="MSAGFEKADTSSEIDGAPAEADLQTALFDVVCDSLSAAFIIYDKN
FT                   DHLVFASRQILEFFPLPSEMLKPGTRLRDFLGAMYDTGIRQQYDVRQGGSLSREDWLSQ
FT                   KIASHWRERFDAVERHGADRWVRFVKRRLPGGYGVSIISDISESKKREEQWRSDLERVQ
FT                   LTEDILDNLPFPLFVKDRNLTYVAVNLAFCEKYQTSADEVLGRKSGDLFSEEIAKRFEE
FT                   SDRHVLETGEMSVSRQRQISRDGIERDIVSRKHRIGKPGRYFLVSTMQDLPRDGADLDE
FT                   FGQASAITASSNQSYRRAYVPVPSGIERREPAAMEAIVPENFSGRKVLVVTADLAAETA
FT                   ALRTLTKYGFESCSVRGEDEEERFLEIATSSGISLDLLIIDNQMGMRCLELAEQYGIPA
FT                   LVMDGFQIANELTFQIARHFNRNSRNAAGSDADWEISTSDDAIGLQVLVAEDNDINQIV
FT                   FSQILEGLGYRHMLAATGDEAVRLWAEHRPQIVLMDISLPGFNGFEAARLIRQMEETGG
FT                   SIRTPIIGVLTQAFERDRAECVKSGMDDVIMKPVSPDMLETIFQKYLMNEAMRAQN"
     MSAGFEKADT SSEIDGAPAE ADLQTALFDV VCDSLSAAFI IYDKNDHLVF ASRQILEFFP        60
     LPSEMLKPGT RLRDFLGAMY DTGIRQQYDV RQGGSLSRED WLSQKIASHW RERFDAVERH       120
     GADRWVRFVK RRLPGGYGVS IISDISESKK REEQWRSDLE RVQLTEDILD NLPFPLFVKD       180
     RNLTYVAVNL AFCEKYQTSA DEVLGRKSGD LFSEEIAKRF EESDRHVLET GEMSVSRQRQ       240
     ISRDGIERDI VSRKHRIGKP GRYFLVSTMQ DLPRDGADLD EFGQASAITA SSNQSYRRAY       300
     VPVPSGIERR EPAAMEAIVP ENFSGRKVLV VTADLAAETA ALRTLTKYGF ESCSVRGEDE       360
     EERFLEIATS SGISLDLLII DNQMGMRCLE LAEQYGIPAL VMDGFQIANE LTFQIARHFN       420
     RNSRNAAGSD ADWEISTSDD AIGLQVLVAE DNDINQIVFS QILEGLGYRH MLAATGDEAV       480
     RLWAEHRPQI VLMDISLPGF NGFEAARLIR QMEETGGSIR TPIIGVLTQA FERDRAECVK       540
     SGMDDVIMKP VSPDMLETIF QKYLMNEAMR AQN                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page