(data stored in ACNUC7421 zone)

EMBL: CP001622.PE533

CP001622.PE533       Location/Qualifiers
FT   CDS             564528..565892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0541"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: ret:RHE_CH00850 putative sensory box/GGDEF
FT                   family protein; TIGRFAM: diguanylate cyclase; PFAM: EAL
FT                   domain protein; GGDEF domain containing protein; SMART: EAL
FT                   domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54845"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M5"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS54845.1"
FT                   /translation="MMKSADIAFLTVGQNELQAMAYTDPLTGLGNRNRMRDKVLQISAE
FT                   RASDPAPFTIGIVNLDSFKPINDLFGSTAGDEILCQVAHRLRACIPDGALVTRHDGDEF
FT                   AFVLPLIFERASAEKFGQMIREVLSAPYDLGDRNVRLSASLGFSIYPFAGEDCEELLKS
FT                   AETALYRSKRRGRGQITVYSREIAQEMKRATQLEQALRNAIISDAIDVHFQPIVSLSNN
FT                   QVVGFEALARWNDPDLGFVSPGVFVPLAEERGFIDALSEALLRKAAEAALSWPRELFLS
FT                   FNLSSAQLMDPGTSSSVLSILGRVGFDPHRLELEITETAVMSSADTAHRIIADLRAAGV
FT                   RISLDDFGTGQSSLGRLRDFIFDKIKIDRAFVSRINSDRASEHIIKAILTMCEGLELEV
FT                   VAEGIEDYAEAVKLRTLGCGMGQGYHFGRPADGIATLRFLHENYYDPTMVERVSA"
     MMKSADIAFL TVGQNELQAM AYTDPLTGLG NRNRMRDKVL QISAERASDP APFTIGIVNL        60
     DSFKPINDLF GSTAGDEILC QVAHRLRACI PDGALVTRHD GDEFAFVLPL IFERASAEKF       120
     GQMIREVLSA PYDLGDRNVR LSASLGFSIY PFAGEDCEEL LKSAETALYR SKRRGRGQIT       180
     VYSREIAQEM KRATQLEQAL RNAIISDAID VHFQPIVSLS NNQVVGFEAL ARWNDPDLGF       240
     VSPGVFVPLA EERGFIDALS EALLRKAAEA ALSWPRELFL SFNLSSAQLM DPGTSSSVLS       300
     ILGRVGFDPH RLELEITETA VMSSADTAHR IIADLRAAGV RISLDDFGTG QSSLGRLRDF       360
     IFDKIKIDRA FVSRINSDRA SEHIIKAILT MCEGLELEVV AEGIEDYAEA VKLRTLGCGM       420
     GQGYHFGRPA DGIATLRFLH ENYYDPTMVE RVSA                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page