(data stored in ACNUC7421 zone)

EMBL: CP001622.PE534

CP001622.PE534       Location/Qualifiers
FT   CDS             complement(565964..566569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0542"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   rec:RHECIAT_CH0000940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54846"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M6"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ACS54846.1"
FT                   /translation="MTRKLLTTVAAGALFATAFAPAAFSQAAPQPADPAAPTQAAPADP
FT                   AAPKPMTPDVTKPAGDAAQAPAAAPTADTAQAGYLTEQSPDQVSANTYIGQSVYNGNNE
FT                   SIGSVNDLILKKDGGFVAAIVGVGGFLGIGEKNVAVPMEKITVAQNTQDGSVKLTTSET
FT                   AESLKAAPEFKTLAMQSAEKAPAATGTDTTATGSTTPK"
     MTRKLLTTVA AGALFATAFA PAAFSQAAPQ PADPAAPTQA APADPAAPKP MTPDVTKPAG        60
     DAAQAPAAAP TADTAQAGYL TEQSPDQVSA NTYIGQSVYN GNNESIGSVN DLILKKDGGF       120
     VAAIVGVGGF LGIGEKNVAV PMEKITVAQN TQDGSVKLTT SETAESLKAA PEFKTLAMQS       180
     AEKAPAATGT DTTATGSTTP K                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page