(data stored in ACNUC7421 zone)

EMBL: CP001622.PE535

CP001622.PE535       Location/Qualifiers
FT   CDS             complement(566803..567690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0543"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: rec:RHECIAT_CH0000941 probable gluconolactonase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54847"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M7"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ACS54847.1"
FT                   /translation="MTDIYEFEGKTLCNTNSVLGEGPTYDPDSNTVWWFNILGKELHEL
FT                   NLSTAAKKVHPLPVMASVLARIDAGRQLIATEEGLFVRDVASGNLTFYAALENDRPENR
FT                   SNDGRTHPSGALWIGTMSKRAENQAGAIYHVASGKVTKIFNGISIPNSICFSPDGTVGY
FT                   YTDSRINRLMRVMVDPLTGLPSGEPIVLVDSMDDPGSIDGSVVDADGYLWNARWGAGVV
FT                   DRYSPDGLRISRYMVPAVQPSCPAFIGVNADRLAVTTAWEGLDEDARSAQPSAGALLEL
FT                   GIDVKGVFDPVYVI"
     MTDIYEFEGK TLCNTNSVLG EGPTYDPDSN TVWWFNILGK ELHELNLSTA AKKVHPLPVM        60
     ASVLARIDAG RQLIATEEGL FVRDVASGNL TFYAALENDR PENRSNDGRT HPSGALWIGT       120
     MSKRAENQAG AIYHVASGKV TKIFNGISIP NSICFSPDGT VGYYTDSRIN RLMRVMVDPL       180
     TGLPSGEPIV LVDSMDDPGS IDGSVVDADG YLWNARWGAG VVDRYSPDGL RISRYMVPAV       240
     QPSCPAFIGV NADRLAVTTA WEGLDEDARS AQPSAGALLE LGIDVKGVFD PVYVI            295
//

If you have problems or comments...

PBIL Back to PBIL home page