(data stored in ACNUC7421 zone)

EMBL: CP001622.PE536

CP001622.PE536       Location/Qualifiers
FT   CDS             complement(567687..568328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0544"
FT                   /product="KDPG and KHG aldolase"
FT                   /note="PFAM: KDPG and KHG aldolase; KEGG: ret:RHE_CH00853
FT                   2-dehydro-3-deoxy-6-phosphogalactonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54848"
FT                   /db_xref="GOA:C6B2M8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M8"
FT                   /inference="protein motif:PFAM:PF01081"
FT                   /protein_id="ACS54848.1"
FT                   /translation="MNRIPFPDMKRPLIAILRGIRPDETESVVGALIDNGLTAIEIPLN
FT                   SPEPFKSIEIAAKMAPAEVLIGAGTVLTVEAVDSLHAAGGKLLVTPNVEPEVIIRARDY
FT                   GMVTMPGVFTPTEALAAARAGATGLKFFPASVLGPSGITAIRAILPPELTIAAVGGVSD
FT                   KNFGDYTKAGIFAFGLGTSIYKPGMTASEVAERAKATIYAYDAAIGSVNV"
     MNRIPFPDMK RPLIAILRGI RPDETESVVG ALIDNGLTAI EIPLNSPEPF KSIEIAAKMA        60
     PAEVLIGAGT VLTVEAVDSL HAAGGKLLVT PNVEPEVIIR ARDYGMVTMP GVFTPTEALA       120
     AARAGATGLK FFPASVLGPS GITAIRAILP PELTIAAVGG VSDKNFGDYT KAGIFAFGLG       180
     TSIYKPGMTA SEVAERAKAT IYAYDAAIGS VNV                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page