(data stored in ACNUC7421 zone)

EMBL: CP001622.PE537

CP001622.PE537       Location/Qualifiers
FT   CDS             complement(568342..569259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0545"
FT                   /product="2-dehydro-3-deoxygalactonokinase"
FT                   /EC_number="2.7.1.58"
FT                   /note="PFAM: 2-keto-3-deoxy-galactonokinase; KEGG:
FT                   ret:RHE_CH00854 2-dehydro-3-deoxygalactonokinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54849"
FT                   /db_xref="GOA:C6B2M9"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M9"
FT                   /inference="protein motif:PRIAM:2.7.1.58"
FT                   /protein_id="ACS54849.1"
FT                   /translation="MANPAYVAVDWGTSSFRLWLISRDGTVLAERRSGEGMTSAAKIGF
FT                   SAVLAGHLAAIEAPENLPVIVCGMAGARQGWVEAGYIDVPAPLASILTGAVSVPGESRD
FT                   IRILPGLAQRDIARPDVMRGEETQLLGALGRASAGAQAVCMPGTHSKWVHVTDSKVTGF
FT                   STFMTGELFDVISKHTILSHAVAGAEEQPADAAAFEAAVSAAFARPALASNLLFAARSG
FT                   QLLHGISAAAAQARLSGTLIGLEIAGALQDAANGTTITLVASGRLQALYEQAVKTLSLA
FT                   FTAIDADAAVRRGLSAAAEAIWPN"
     MANPAYVAVD WGTSSFRLWL ISRDGTVLAE RRSGEGMTSA AKIGFSAVLA GHLAAIEAPE        60
     NLPVIVCGMA GARQGWVEAG YIDVPAPLAS ILTGAVSVPG ESRDIRILPG LAQRDIARPD       120
     VMRGEETQLL GALGRASAGA QAVCMPGTHS KWVHVTDSKV TGFSTFMTGE LFDVISKHTI       180
     LSHAVAGAEE QPADAAAFEA AVSAAFARPA LASNLLFAAR SGQLLHGISA AAAQARLSGT       240
     LIGLEIAGAL QDAANGTTIT LVASGRLQAL YEQAVKTLSL AFTAIDADAA VRRGLSAAAE       300
     AIWPN                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page