(data stored in ACNUC7421 zone)

EMBL: CP001622.PE538

CP001622.PE538       Location/Qualifiers
FT   CDS             complement(569259..570032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0546"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ret:RHE_CH00855 3-oxoacyl-(acyl carrier protein) reductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54850"
FT                   /db_xref="GOA:C6B2N0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54850.1"
FT                   /translation="MTMMPAAQFPEFKNRAVLVTGGGSGIGAAIVEGFARQGAKVSFID
FT                   IAEAAGRELAERLSRETTHPVSFHHADLRDIAAIRRTVDSVIASSGPIRVLVNNAAWDD
FT                   RHEFDAVTEAYWDNNQAVNLKHVFFTSQAVVPSMRAAGGGAIINMSSIAFKLNMGGFPA
FT                   YAAAKAAVVGLTKSMAGRLGPENIRVNCILPGMVVTERQMQHWLTEESIARSVEDQCLK
FT                   VALKPDAIVGPCLFLASDCAAAMTAQSLIVDGGVL"
     MTMMPAAQFP EFKNRAVLVT GGGSGIGAAI VEGFARQGAK VSFIDIAEAA GRELAERLSR        60
     ETTHPVSFHH ADLRDIAAIR RTVDSVIASS GPIRVLVNNA AWDDRHEFDA VTEAYWDNNQ       120
     AVNLKHVFFT SQAVVPSMRA AGGGAIINMS SIAFKLNMGG FPAYAAAKAA VVGLTKSMAG       180
     RLGPENIRVN CILPGMVVTE RQMQHWLTEE SIARSVEDQC LKVALKPDAI VGPCLFLASD       240
     CAAAMTAQSL IVDGGVL                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page