(data stored in ACNUC7421 zone)

EMBL: CP001622.PE539

CP001622.PE539       Location/Qualifiers
FT   CDS             570135..570932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0547"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Transcriptional regulator IclR; regulatory
FT                   protein IclR; SMART: regulatory protein IclR; KEGG:
FT                   ret:RHE_CH00856 IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54851"
FT                   /db_xref="GOA:C6B2N1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N1"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ACS54851.1"
FT                   /translation="MNSNGDGAAQARETGTLGKLMVLLDLVTHADAPLRFTDILALAGQ
FT                   PRGTLHRQLSHLVEEGLLELDGDGRYAPGLRLLDFAARSWARNEFRLIAEPHLRDLQQA
FT                   TGETVHLGVLRGQSIIYLDKVEGRQPVRMYSQIGNASPCYCTGVGKAALSLLPAESLVD
FT                   LIAGLSFTSFTASTHVSAETLLAEIREIADQGYAFDREEHEAGIRCVAAPVWSEDRTFM
FT                   GGISITGPAYRLSMELLHQWTVPVQLAAVRIMEGMRVRLGPRR"
     MNSNGDGAAQ ARETGTLGKL MVLLDLVTHA DAPLRFTDIL ALAGQPRGTL HRQLSHLVEE        60
     GLLELDGDGR YAPGLRLLDF AARSWARNEF RLIAEPHLRD LQQATGETVH LGVLRGQSII       120
     YLDKVEGRQP VRMYSQIGNA SPCYCTGVGK AALSLLPAES LVDLIAGLSF TSFTASTHVS       180
     AETLLAEIRE IADQGYAFDR EEHEAGIRCV AAPVWSEDRT FMGGISITGP AYRLSMELLH       240
     QWTVPVQLAA VRIMEGMRVR LGPRR                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page