(data stored in ACNUC7421 zone)

EMBL: CP001622.PE54

CP001622.PE54        Location/Qualifiers
FT   CDS             complement(56302..56892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0055"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rec:RHECIAT_CH0000437
FT                   putative hydrolase protein, MutT/NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54366"
FT                   /db_xref="GOA:C6AYE2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE2"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACS54366.1"
FT                   /translation="MNDELKPWSVTASRITYEDRWIRVRSDDCVTADGTVVAPFHVLDY
FT                   PDWINVIPVMPDGRVLLTREYRHGRGEIVLGLVAGSLEPGDSETGDAAMAAARRELREE
FT                   TGYEASTFVKLLTSYPNAASHSNVVTSWLALGLSRAGEPSFDPGEKVELLFTDLAAILG
FT                   DLQSGAVIMQSMHVAALYAAESWLRTQASEGVK"
     MNDELKPWSV TASRITYEDR WIRVRSDDCV TADGTVVAPF HVLDYPDWIN VIPVMPDGRV        60
     LLTREYRHGR GEIVLGLVAG SLEPGDSETG DAAMAAARRE LREETGYEAS TFVKLLTSYP       120
     NAASHSNVVT SWLALGLSRA GEPSFDPGEK VELLFTDLAA ILGDLQSGAV IMQSMHVAAL       180
     YAAESWLRTQ ASEGVK                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page