(data stored in ACNUC7421 zone)

EMBL: CP001622.PE540

CP001622.PE540       Location/Qualifiers
FT   CDS             571190..571924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0548"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: Autoinducer-binding domain protein; regulatory
FT                   protein LuxR; Bacterio-opsin activator HTH domain protein;
FT                   SMART: regulatory protein LuxR; KEGG: rec:RHECIAT_CH0000947
FT                   putative transcriptional regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54852"
FT                   /db_xref="GOA:C6B2N2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N2"
FT                   /inference="protein motif:PFAM:PF03472"
FT                   /protein_id="ACS54852.1"
FT                   /translation="MAPLSQTSTEEDDYVQEIAGLKTQFDIFRFMKRVTEAYRSRAFMV
FT                   LNLPPITSFDLQGSTVITSWPAELLALYDQEGLMVNSPVLRRLRTSARPFFYDMSRQNL
FT                   SRDDGKSILVASLFERFKMMRCAYFPTHEPSGLRGAISFAGDREPFSPAEMRELCYISI
FT                   HIFDRLAEIRNLDTRMTDTLTDREIDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRAT
FT                   KKLDTVNRTQAVAKALRIGLIK"
     MAPLSQTSTE EDDYVQEIAG LKTQFDIFRF MKRVTEAYRS RAFMVLNLPP ITSFDLQGST        60
     VITSWPAELL ALYDQEGLMV NSPVLRRLRT SARPFFYDMS RQNLSRDDGK SILVASLFER       120
     FKMMRCAYFP THEPSGLRGA ISFAGDREPF SPAEMRELCY ISIHIFDRLA EIRNLDTRMT       180
     DTLTDREIDC LNWTAAGKTS AEIAEILTLS EHTVNHYLNR ATKKLDTVNR TQAVAKALRI       240
     GLIK                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page