(data stored in ACNUC7421 zone)

EMBL: CP001622.PE541

CP001622.PE541       Location/Qualifiers
FT   CDS             572458..573624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0549"
FT                   /product="protein of unknown function DUF59"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   ret:RHE_CH00859 ATP-binding protein (Mrp protein-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54853"
FT                   /db_xref="GOA:C6B2N3"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N3"
FT                   /inference="protein motif:PFAM:PF01883"
FT                   /protein_id="ACS54853.1"
FT                   /translation="MADVTKEQVLETLKTVRGPDLEHDIVELGMVSDVFISDGKVYFSI
FT                   TVPADRAKELEPMRLAAERVIKEMPGVKGALVTLTADKKAAAAAPAARPAANPPHGHAG
FT                   HDHGSHAHAPQQPPRAGKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGI
FT                   LDADIYGPSMPRLLKISGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQ
FT                   SALLQMLREVAWGELDVLVVDMPPGTGDVQLTMAQQVPLAGAVIVSTPQDLALIDARKG
FT                   LNMFRKVEVPVLGIVENMSYFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNI
FT                   RETSDAGTPLVASEPNGVVAGIYRGIAAKVWEQVAGQPQRPAPTIVFE"
     MADVTKEQVL ETLKTVRGPD LEHDIVELGM VSDVFISDGK VYFSITVPAD RAKELEPMRL        60
     AAERVIKEMP GVKGALVTLT ADKKAAAAAP AARPAANPPH GHAGHDHGSH AHAPQQPPRA       120
     GKIGVPGIGA IIAVASGKGG VGKSTTAVNL ALGLLANGLR VGILDADIYG PSMPRLLKIS       180
     GRPTQIDGRI INPMENYGLK VMSMGFLVDE ETAMIWRGPM VQSALLQMLR EVAWGELDVL       240
     VVDMPPGTGD VQLTMAQQVP LAGAVIVSTP QDLALIDARK GLNMFRKVEV PVLGIVENMS       300
     YFIAPDTGTR YDIFGHGGAR KEAERIGVPF LGEVPLTMNI RETSDAGTPL VASEPNGVVA       360
     GIYRGIAAKV WEQVAGQPQR PAPTIVFE                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page