(data stored in ACNUC7421 zone)

EMBL: CP001622.PE542

CP001622.PE542       Location/Qualifiers
FT   CDS             574069..575046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0550"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: ret:RHE_CH00860 magnesium/cobalt transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54854"
FT                   /db_xref="GOA:C6B2N4"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N4"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ACS54854.1"
FT                   /translation="MITAYCSNCKSVEIGDLSHAASFPEDVVWIDMIEPTRDEELYVEK
FT                   VLGIEVPTRDDLKDIEPSARLYVENDAVFMTASLLWKADTDVPTLTDVAFILAGNRLVT
FT                   IRYAHPKSFALFIAALHRLPENWRSGAALLAKLLETIVDRTAEILEIAVSRLDILSMHV
FT                   FGERARKVRKPSNYLEEKLRDIAGHHRMISKVRDSLGSLARLLTFFHTIPAIQQDREAK
FT                   ELCRTVSRDIQSLSEHASFVAANITFLLDASLGLINIEQNSIIKIFSIASVVFLPPTLV
FT                   ASVYGMNFQVMPELTWAAGYPYSLALMVISAVIPFFFFRWKGWL"
     MITAYCSNCK SVEIGDLSHA ASFPEDVVWI DMIEPTRDEE LYVEKVLGIE VPTRDDLKDI        60
     EPSARLYVEN DAVFMTASLL WKADTDVPTL TDVAFILAGN RLVTIRYAHP KSFALFIAAL       120
     HRLPENWRSG AALLAKLLET IVDRTAEILE IAVSRLDILS MHVFGERARK VRKPSNYLEE       180
     KLRDIAGHHR MISKVRDSLG SLARLLTFFH TIPAIQQDRE AKELCRTVSR DIQSLSEHAS       240
     FVAANITFLL DASLGLINIE QNSIIKIFSI ASVVFLPPTL VASVYGMNFQ VMPELTWAAG       300
     YPYSLALMVI SAVIPFFFFR WKGWL                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page