(data stored in ACNUC7421 zone)

EMBL: CP001622.PE543

CP001622.PE543       Location/Qualifiers
FT   CDS             575065..576963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0551"
FT                   /product="K potassium transporter"
FT                   /note="PFAM: K potassium transporter; KEGG:
FT                   rec:RHECIAT_CH0000951 potassium transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54855"
FT                   /db_xref="GOA:C6B2N5"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N5"
FT                   /inference="protein motif:PFAM:PF02705"
FT                   /protein_id="ACS54855.1"
FT                   /translation="MSEESHPNERHMTPRKLFYLALGSVGVVYGDIGTSPLYAFREALK
FT                   PVAHDGVTRFEVISLISLMIWALTIIVTIKYVLFLLRADNDGEGGTLSLLALLMKTANG
FT                   HTAILMLLGLMGAALFLGDAMITPALSVLSAVEGLKLVTPRLADYIVPISVVILALLFV
FT                   VQSRGTGAVARFFGPITAVWFLVMAAAGISHISDDYGILAAFNPYYAVSFLLHEGFYGV
FT                   VVLGAVFLTVTGAEALYADLGHFGRRPIQWAWFMLVFPALTLNYLGQGALVLGNPATMS
FT                   DPFYLMFPKWALLPVVILATAATIIASQAVITGAFSMVRQGINLGFLPRMEILFTSETN
FT                   TGQIFVPSVNAVLFIGVIFLVLSFKTSDALATAYGISVTGAMVVTSIMAFEFVRARWNW
FT                   SLPVAVIALAPLVVLEMIFLGANLLKIHDGGYIPIMIATAFTVVMWTWRRGTAILMEKT
FT                   RHTDIPLASFVSSIERKSEHSPAQVPGTAIFLTSDPESAPAALLHNLKHNHVLHDRNVI
FT                   LTIRTINKPRVPSHDRYKIEQISERFSRVELLFGFMESQNVSQALATLRKTGLKFDIMS
FT                   TSFYLGRRKLVPDAKSGMPYWQDRLYIALANAAANPSDYFRLPANRVVELGSHVII"
     MSEESHPNER HMTPRKLFYL ALGSVGVVYG DIGTSPLYAF REALKPVAHD GVTRFEVISL        60
     ISLMIWALTI IVTIKYVLFL LRADNDGEGG TLSLLALLMK TANGHTAILM LLGLMGAALF       120
     LGDAMITPAL SVLSAVEGLK LVTPRLADYI VPISVVILAL LFVVQSRGTG AVARFFGPIT       180
     AVWFLVMAAA GISHISDDYG ILAAFNPYYA VSFLLHEGFY GVVVLGAVFL TVTGAEALYA       240
     DLGHFGRRPI QWAWFMLVFP ALTLNYLGQG ALVLGNPATM SDPFYLMFPK WALLPVVILA       300
     TAATIIASQA VITGAFSMVR QGINLGFLPR MEILFTSETN TGQIFVPSVN AVLFIGVIFL       360
     VLSFKTSDAL ATAYGISVTG AMVVTSIMAF EFVRARWNWS LPVAVIALAP LVVLEMIFLG       420
     ANLLKIHDGG YIPIMIATAF TVVMWTWRRG TAILMEKTRH TDIPLASFVS SIERKSEHSP       480
     AQVPGTAIFL TSDPESAPAA LLHNLKHNHV LHDRNVILTI RTINKPRVPS HDRYKIEQIS       540
     ERFSRVELLF GFMESQNVSQ ALATLRKTGL KFDIMSTSFY LGRRKLVPDA KSGMPYWQDR       600
     LYIALANAAA NPSDYFRLPA NRVVELGSHV II                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page