(data stored in ACNUC7421 zone)

EMBL: CP001622.PE544

CP001622.PE544       Location/Qualifiers
FT   CDS             577228..578457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0552"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="PFAM: cell wall hydrolase SleB; KEGG:
FT                   rec:RHECIAT_CH0000952 putative cell wall hydrolase protein
FT                   involved in spore germination"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54856"
FT                   /db_xref="GOA:C6B2N6"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N6"
FT                   /inference="protein motif:PFAM:PF07486"
FT                   /protein_id="ACS54856.1"
FT                   /translation="MECSSVPCPESVLRRKSPSRSKLRLFPENWVSPVIFGLAGWLIFP
FT                   SVASHADLAAMLAGLDHEGGNWRMVLTNSPAGSIHQAELAFAEPMVTGSIAADAGMVLP
FT                   DGRKVAFNAKDKGTAKDRGHEDTPDEDRVNRSAKKGRVVAVEKMQPPKDFSAGSILERT
FT                   KMLFTPSFDLKDRSAFVKPKIQGKEIEIATSFYKKQPVVTDNGVPAMLASLVTNNKADV
FT                   LATAYAPAAPDYARQSPFDSILAEPDSGRFVPEIGPRDHAWAASVLAPSVFSAREQQCL
FT                   ASGIYFEARGESVKGQAAVAQVILNRVRNPSYPKTICGVVYQNEDWRNRCQFSFACDSI
FT                   KDRVNSEYHWRVARDVAMAVTSGKIWLLQVGSATHYHAVYVRPKWAKTMEKVGRIGLHV
FT                   FYRTYGGGWS"
     MECSSVPCPE SVLRRKSPSR SKLRLFPENW VSPVIFGLAG WLIFPSVASH ADLAAMLAGL        60
     DHEGGNWRMV LTNSPAGSIH QAELAFAEPM VTGSIAADAG MVLPDGRKVA FNAKDKGTAK       120
     DRGHEDTPDE DRVNRSAKKG RVVAVEKMQP PKDFSAGSIL ERTKMLFTPS FDLKDRSAFV       180
     KPKIQGKEIE IATSFYKKQP VVTDNGVPAM LASLVTNNKA DVLATAYAPA APDYARQSPF       240
     DSILAEPDSG RFVPEIGPRD HAWAASVLAP SVFSAREQQC LASGIYFEAR GESVKGQAAV       300
     AQVILNRVRN PSYPKTICGV VYQNEDWRNR CQFSFACDSI KDRVNSEYHW RVARDVAMAV       360
     TSGKIWLLQV GSATHYHAVY VRPKWAKTME KVGRIGLHVF YRTYGGGWS                   409
//

If you have problems or comments...

PBIL Back to PBIL home page