(data stored in ACNUC7421 zone)

EMBL: CP001622.PE545

CP001622.PE545       Location/Qualifiers
FT   CDS             578729..579067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0553"
FT                   /product="ATP synthase protein, subunit I"
FT                   /note="KEGG: rec:RHECIAT_CH0000953 ATP synthase protein,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54857"
FT                   /db_xref="GOA:C6B2N7"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000953"
FT                   /protein_id="ACS54857.1"
FT                   /translation="MADDREESLEKRRAQLGAKLATKGVETGEDEAREARAEVSRKGYA
FT                   QAMKLSSEFISAIVVGALLGYLLDRFVGTAPWGLIVLLLLGFCAGVLNVLRSAGVVAHP
FT                   LDDKDDKK"
     MADDREESLE KRRAQLGAKL ATKGVETGED EAREARAEVS RKGYAQAMKL SSEFISAIVV        60
     GALLGYLLDR FVGTAPWGLI VLLLLGFCAG VLNVLRSAGV VAHPLDDKDD KK               112
//

If you have problems or comments...

PBIL Back to PBIL home page