(data stored in ACNUC7421 zone)

EMBL: CP001622.PE546

CP001622.PE546       Location/Qualifiers
FT   CDS             579130..579882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0554"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   rec:RHECIAT_CH0000954 ATP synthase protein, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54858"
FT                   /db_xref="GOA:C6B2N8"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N8"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ACS54858.1"
FT                   /translation="MSNDPTHQFLIQKIVPIEIGGIDFSFTNASLFMAVSAAAAAGFLY
FT                   FATSNRAIVPGRSQSVAEMSYEFIANMLKEGAGKQGMKFFPLVFSLFMFVLTANLLGMF
FT                   PYFFTVTSQIIVTFALAILVIGTVLVYGFYKHGFHFLNVFVPSGVPGLLLPLVVTIEII
FT                   SFLSRPISLSVRLFANMLAGHITLKVFAGFVASLGTMGALGIGGAVLPLIMTVALTGLE
FT                   FLVAFLQAYVFAVLTCMYLNDAIHPGGH"
     MSNDPTHQFL IQKIVPIEIG GIDFSFTNAS LFMAVSAAAA AGFLYFATSN RAIVPGRSQS        60
     VAEMSYEFIA NMLKEGAGKQ GMKFFPLVFS LFMFVLTANL LGMFPYFFTV TSQIIVTFAL       120
     AILVIGTVLV YGFYKHGFHF LNVFVPSGVP GLLLPLVVTI EIISFLSRPI SLSVRLFANM       180
     LAGHITLKVF AGFVASLGTM GALGIGGAVL PLIMTVALTG LEFLVAFLQA YVFAVLTCMY       240
     LNDAIHPGGH                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page