(data stored in ACNUC7421 zone)

EMBL: CP001622.PE548

CP001622.PE548       Location/Qualifiers
FT   CDS             580255..580878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0556"
FT                   /product="H+transporting two-sector ATPase B/B' subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase B/B' subunit;
FT                   ATPase F0 complex subunit 8; KEGG: rec:RHECIAT_CH0000956
FT                   ATP synthase protein, subunit B'"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54860"
FT                   /db_xref="GOA:C6B2P0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P0"
FT                   /inference="protein motif:PFAM:PF00430"
FT                   /protein_id="ACS54860.1"
FT                   /translation="MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGP
FT                   FPPFDSTTFASQLLWLVITFGVFYLLMQKVIAPRIGTILDQRHTRISQDLEEAGRLKAE
FT                   ADAAVRTYEGELAAARAKSNAIGSAARDAAKAKAEEERRAVEASLSEKIKAAELRIGEI
FT                   KAKAFADVGTIAEETAAAVVDQLIGGTVAKADVAAAVAAAKKEA"
     MFFVTPAYAE EAPAAATGTD AHAAPAAGEV HTETGVAEGE HARGPFPPFD STTFASQLLW        60
     LVITFGVFYL LMQKVIAPRI GTILDQRHTR ISQDLEEAGR LKAEADAAVR TYEGELAAAR       120
     AKSNAIGSAA RDAAKAKAEE ERRAVEASLS EKIKAAELRI GEIKAKAFAD VGTIAEETAA       180
     AVVDQLIGGT VAKADVAAAV AAAKKEA                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page