(data stored in ACNUC7421 zone)

EMBL: CP001622.PE549

CP001622.PE549       Location/Qualifiers
FT   CDS             580882..581373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0557"
FT                   /product="H+transporting two-sector ATPase B/B' subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase B/B' subunit;
FT                   KEGG: ret:RHE_CH00867 F0F1 ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54861"
FT                   /db_xref="GOA:C6B2P1"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P1"
FT                   /inference="protein motif:PFAM:PF00430"
FT                   /protein_id="ACS54861.1"
FT                   /translation="MEFAFDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNE
FT                   LAEAKRLREEAQHLLAEYQRKRKEAEAEAAHIVAAAEREAEMLTAEAKKKTEEFVANRT
FT                   ALSEQKIKQAEVEAMKAVRSAAVDLAIAAAETVLAKRADTKIQSELFGNAVGQVKTRLN
FT                   "
     MEFAFDATFF AFVGLVLFLA LVVYLKVPGM MARSLDDRAD QIRNELAEAK RLREEAQHLL        60
     AEYQRKRKEA EAEAAHIVAA AEREAEMLTA EAKKKTEEFV ANRTALSEQK IKQAEVEAMK       120
     AVRSAAVDLA IAAAETVLAK RADTKIQSEL FGNAVGQVKT RLN                         163
//

If you have problems or comments...

PBIL Back to PBIL home page