(data stored in ACNUC7421 zone)

EMBL: CP001622.PE55

CP001622.PE55        Location/Qualifiers
FT   CDS             57016..57471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0056"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   rec:RHECIAT_CH0000438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54367"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE3"
FT                   /inference="protein motif:PFAM:PF06240"
FT                   /protein_id="ACS54367.1"
FT                   /translation="MDFTGEERIAAPRDIVWAALNDPEIMRGCIPGCQSIERLSPDVFE
FT                   ATIKVKFSLLSATFHGLLTLSNVDAPKSYTLSAEGKGGLAGFARGSADIVLEERGAETI
FT                   LHYRSKAELGGRLAQLGARLLDSTSQKLAEGFFSDFNAAVVAKMAAG"
     MDFTGEERIA APRDIVWAAL NDPEIMRGCI PGCQSIERLS PDVFEATIKV KFSLLSATFH        60
     GLLTLSNVDA PKSYTLSAEG KGGLAGFARG SADIVLEERG AETILHYRSK AELGGRLAQL       120
     GARLLDSTSQ KLAEGFFSDF NAAVVAKMAA G                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page