(data stored in ACNUC7421 zone)

EMBL: CP001622.PE552

CP001622.PE552       Location/Qualifiers
FT   CDS             complement(583112..583801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0560"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG:
FT                   rec:RHECIAT_CH0000958 ribonuclease HII protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54864"
FT                   /db_xref="GOA:C6B2P4"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P4"
FT                   /inference="protein motif:PRIAM:3.1.26.4"
FT                   /protein_id="ACS54864.1"
FT                   /translation="MKPRTSPDSPLLFDTAPLVPDFRLELKARKAGHWPVAGADEAGRG
FT                   PLAGPVVAAAVILDPRRIPEGLNDSKQLSAQRREELFVQILATATVSIASSSSTRIDET
FT                   DIRKASLDAMRRAICSLAIPASYVLTDGLDVPPGLDCPGQAVVKGDARSVSIAAASIVA
FT                   KVTRDRMMARAHSVFPDYGFAAHVGYGTAQHRAGIERHGPCSLHRMSFRPLRKTEGAPE
FT                   TDELLSE"
     MKPRTSPDSP LLFDTAPLVP DFRLELKARK AGHWPVAGAD EAGRGPLAGP VVAAAVILDP        60
     RRIPEGLNDS KQLSAQRREE LFVQILATAT VSIASSSSTR IDETDIRKAS LDAMRRAICS       120
     LAIPASYVLT DGLDVPPGLD CPGQAVVKGD ARSVSIAAAS IVAKVTRDRM MARAHSVFPD       180
     YGFAAHVGYG TAQHRAGIER HGPCSLHRMS FRPLRKTEGA PETDELLSE                   229
//

If you have problems or comments...

PBIL Back to PBIL home page