(data stored in ACNUC7421 zone)

EMBL: CP001622.PE553

CP001622.PE553       Location/Qualifiers
FT   CDS             complement(583964..585121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0561"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: ret:RHE_CH00869 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54865"
FT                   /db_xref="GOA:C6B2P5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P5"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACS54865.1"
FT                   /translation="MREQSLAGQAAFAPANTADIADAMIVSSGLRVEVDRRRGRGAGLN
FT                   PTGRFEAQQRETVDDGWQTWEELPPFKTEVQVEKPRTAITRNESPDIPFDRSINPYRGC
FT                   EHGCIYCFARPTHAYMGLSAGLDFETKLFAKPDAAKLLERELAKPGYKVRVIAIGTNTD
FT                   PYQPIEKEWRIMRGILEVLNKANHPVSIVTKSAMILRDLDILQEMAAKNLVRVGISVTT
FT                   LDRKLARTMEPRAATPPRRLETIHTLAEAGIQTAVLAAPLIPALNDHELERILESAKAA
FT                   GAAEASYVILRLPLEVSPLFRDWLLQHYPDRYRHVMSLVRSMRGGKDYDAEFGKRMKGA
FT                   GPYAWQIARRFEMAARRFQLTRRSMPLRDDLFVPPDGSGVQLSLL"
     MREQSLAGQA AFAPANTADI ADAMIVSSGL RVEVDRRRGR GAGLNPTGRF EAQQRETVDD        60
     GWQTWEELPP FKTEVQVEKP RTAITRNESP DIPFDRSINP YRGCEHGCIY CFARPTHAYM       120
     GLSAGLDFET KLFAKPDAAK LLERELAKPG YKVRVIAIGT NTDPYQPIEK EWRIMRGILE       180
     VLNKANHPVS IVTKSAMILR DLDILQEMAA KNLVRVGISV TTLDRKLART MEPRAATPPR       240
     RLETIHTLAE AGIQTAVLAA PLIPALNDHE LERILESAKA AGAAEASYVI LRLPLEVSPL       300
     FRDWLLQHYP DRYRHVMSLV RSMRGGKDYD AEFGKRMKGA GPYAWQIARR FEMAARRFQL       360
     TRRSMPLRDD LFVPPDGSGV QLSLL                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page