(data stored in ACNUC7421 zone)

EMBL: CP001622.PE554

CP001622.PE554       Location/Qualifiers
FT   CDS             585222..585779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0562"
FT                   /product="putative glycosyltransferase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000960 putative
FT                   glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54866"
FT                   /db_xref="GOA:C6B2P6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000960"
FT                   /protein_id="ACS54866.1"
FT                   /translation="MLAKICAAHYKWSMLTVVLECQDQESELAQTLSVLVAGAVEGLVS
FT                   DVVVLDHGSRDGTSRVADAAGCRFHSQWDIKDIVRSARGEWLLFVEPGARPQAGWIDEI
FT                   AEYVALNKLPARFTASRAYRRPFFQRVGRAVPPLELGFLLPKKQALAIAKSGMRLTEFV
FT                   KGQKPRKLASELIPSWVARAAR"
     MLAKICAAHY KWSMLTVVLE CQDQESELAQ TLSVLVAGAV EGLVSDVVVL DHGSRDGTSR        60
     VADAAGCRFH SQWDIKDIVR SARGEWLLFV EPGARPQAGW IDEIAEYVAL NKLPARFTAS       120
     RAYRRPFFQR VGRAVPPLEL GFLLPKKQAL AIAKSGMRLT EFVKGQKPRK LASELIPSWV       180
     ARAAR                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page