(data stored in ACNUC7421 zone)

EMBL: CP001622.PE555

CP001622.PE555       Location/Qualifiers
FT   CDS             585961..586296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54867"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P7"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00871"
FT                   /protein_id="ACS54867.1"
FT                   /translation="MARGRIYGVRSMIYGLIAVILPTLVIAHPHSAASQMMRSCAGRPE
FT                   IVNFLDKNFAEKLTAVGLINENAILEVYAAESGTWTLIVTDVHGISCVLLSGDSWDTMP
FT                   VLPGLAT"
     MARGRIYGVR SMIYGLIAVI LPTLVIAHPH SAASQMMRSC AGRPEIVNFL DKNFAEKLTA        60
     VGLINENAIL EVYAAESGTW TLIVTDVHGI SCVLLSGDSW DTMPVLPGLA T                111
//

If you have problems or comments...

PBIL Back to PBIL home page