(data stored in ACNUC7421 zone)

EMBL: CP001622.PE556

CP001622.PE556       Location/Qualifiers
FT   CDS             complement(586330..586881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0564"
FT                   /product="molybdenum cofactor biosynthesis protein B"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein B;
FT                   molybdenum cofactor synthesis domain protein; PFAM:
FT                   molybdopterin binding domain; KEGG: ret:RHE_CH00872
FT                   molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54868"
FT                   /db_xref="GOA:C6B2P8"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P8"
FT                   /inference="protein motif:TFAM:TIGR02667"
FT                   /protein_id="ACS54868.1"
FT                   /translation="MAGLDEKRPFIAVGIAVLTISDTRTPETDKSGDTLAARIREAGHR
FT                   LVDRGIVPDDREKIAARVKAWTENQDIDVVITTGGTGFTGRDVTPEALEPLFEKRMDGF
FT                   SAIFHRISYEKIGTATIQSRATAGVANATFIFVLPGSPGACRDAWDGILKGQLDYRSAP
FT                   CNFVEIMPRLDEHLKRGATK"
     MAGLDEKRPF IAVGIAVLTI SDTRTPETDK SGDTLAARIR EAGHRLVDRG IVPDDREKIA        60
     ARVKAWTENQ DIDVVITTGG TGFTGRDVTP EALEPLFEKR MDGFSAIFHR ISYEKIGTAT       120
     IQSRATAGVA NATFIFVLPG SPGACRDAWD GILKGQLDYR SAPCNFVEIM PRLDEHLKRG       180
     ATK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page