(data stored in ACNUC7421 zone)

EMBL: CP001622.PE557

CP001622.PE557       Location/Qualifiers
FT   CDS             complement(586881..587792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0565"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: ret:RHE_CH00873
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54869"
FT                   /db_xref="GOA:C6B2P9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P9"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACS54869.1"
FT                   /translation="MMSSENRSHFSASCSSFSEEARAKINLALHVTGQRPDGYHLLDML
FT                   VTFADHGDRLDFMRSPTDALTLSGRFGETLAGDGGTNLVLKARDLLREVVGPLAFPVRI
FT                   HLEKNLPIASGIGGGSADAAATLRGLMRLWGTTLSAETLAALALKLGADVPMCLESRPL
FT                   IARGIGEKIEPVPDLPAFAMVLANPLKGVATPEVFRRLATKNNPALSLALSGSQAADWL
FT                   AAIAAARNDLEPPARGLVPEIAAISAMLQARGALLTRMSGSGATCFGIFASMTAAEGAA
FT                   AALHDKRPDWYFQATETVSGGA"
     MMSSENRSHF SASCSSFSEE ARAKINLALH VTGQRPDGYH LLDMLVTFAD HGDRLDFMRS        60
     PTDALTLSGR FGETLAGDGG TNLVLKARDL LREVVGPLAF PVRIHLEKNL PIASGIGGGS       120
     ADAAATLRGL MRLWGTTLSA ETLAALALKL GADVPMCLES RPLIARGIGE KIEPVPDLPA       180
     FAMVLANPLK GVATPEVFRR LATKNNPALS LALSGSQAAD WLAAIAAARN DLEPPARGLV       240
     PEIAAISAML QARGALLTRM SGSGATCFGI FASMTAAEGA AAALHDKRPD WYFQATETVS       300
     GGA                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page