(data stored in ACNUC7421 zone)

EMBL: CP001622.PE558

CP001622.PE558       Location/Qualifiers
FT   CDS             complement(587844..589676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0566"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG:
FT                   rec:RHECIAT_CH0000964 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54870"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q0"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACS54870.1"
FT                   /translation="MRQRLAIRLLTSAALAAVLSLSGVGGANAEDAAKTDDAGTAVHFD
FT                   ADSVTTFSGAFLAARTADVDHDYETAIELYKKALQIEPGNPEIRQRLMISLLLNGDIKD
FT                   GVKYANDLKGDPSVERITTIVRGMDAVRRDDYKSAEAILKYKGPNDLDRMMNDLLLAWA
FT                   RVGAGRGKEALTMVEKMKGPDWFRIFQNYNAGAIAIVTGDVKSARQHLNDAVLDKEGGA
FT                   TAPDTFMRAVMALARLEATQGNKQKALDAVSVGDNLLPNYAPLNALRDSIEKNEKQDQQ
FT                   VKTAEEGAAGVLFSVGGALNRDGAEDIVSLYLQTANALDPNSADTLVLLGGIAEKQNQM
FT                   DRAIALYKKVPENSPMRRISELQLGLALAQGGKVDEARKHLQALITSDPKDIRSYLAYG
FT                   SVLSDAKDYQAMATNYDKAVETIGPIPGRANWSVFFQRGIAYERLKKWDQAEPNFRKAL
FT                   ELNPDQPQVLNYLGYSWIDMNRNLDEGLGMIKKAVDLRPDDGYIIDSLGWAYFRLNRFD
FT                   DAVDELERAAQIKAGDATINDHLGDAYWRVGRKLEAVYQWNRALASEPEAAEIPKIKDK
FT                   VANGLPPASDDAKAADKKQPDPAPVTPPPVDKKS"
     MRQRLAIRLL TSAALAAVLS LSGVGGANAE DAAKTDDAGT AVHFDADSVT TFSGAFLAAR        60
     TADVDHDYET AIELYKKALQ IEPGNPEIRQ RLMISLLLNG DIKDGVKYAN DLKGDPSVER       120
     ITTIVRGMDA VRRDDYKSAE AILKYKGPND LDRMMNDLLL AWARVGAGRG KEALTMVEKM       180
     KGPDWFRIFQ NYNAGAIAIV TGDVKSARQH LNDAVLDKEG GATAPDTFMR AVMALARLEA       240
     TQGNKQKALD AVSVGDNLLP NYAPLNALRD SIEKNEKQDQ QVKTAEEGAA GVLFSVGGAL       300
     NRDGAEDIVS LYLQTANALD PNSADTLVLL GGIAEKQNQM DRAIALYKKV PENSPMRRIS       360
     ELQLGLALAQ GGKVDEARKH LQALITSDPK DIRSYLAYGS VLSDAKDYQA MATNYDKAVE       420
     TIGPIPGRAN WSVFFQRGIA YERLKKWDQA EPNFRKALEL NPDQPQVLNY LGYSWIDMNR       480
     NLDEGLGMIK KAVDLRPDDG YIIDSLGWAY FRLNRFDDAV DELERAAQIK AGDATINDHL       540
     GDAYWRVGRK LEAVYQWNRA LASEPEAAEI PKIKDKVANG LPPASDDAKA ADKKQPDPAP       600
     VTPPPVDKKS                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page