(data stored in ACNUC7421 zone)

EMBL: CP001622.PE559

CP001622.PE559       Location/Qualifiers
FT   CDS             complement(589810..590826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0567"
FT                   /product="Farnesyltranstransferase"
FT                   /EC_number="2.5.1.29"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: ret:RHE_CH00875
FT                   octaprenyl-diphosphate synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54871"
FT                   /db_xref="GOA:C6B2Q1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q1"
FT                   /inference="protein motif:PRIAM:2.5.1.29"
FT                   /protein_id="ACS54871.1"
FT                   /translation="MGVVIPLEESKNKLASIKPLVDLTRADMERVNQLILSKAGSDVQM
FT                   IPEVANHLISSGGKRLRPMLTLASASLFDYRGENHVKLATSVEFMHTATLLHDDVVDES
FT                   DLRRGKSTARMIWGNQASVLVGDFLLGQAFRMMVDVGSLDALDVLSSAACVIAEGEVLQ
FT                   LSVAKNMETTEDDYLSVIRAKTAALFAAAAEVGPIVAEAGRSGRNALKSYGMNLGLAFQ
FT                   LVDDALDYGGKAADLGKNVGDDFREGKITLPVILAYRRGTEDERAFWRDAIEAGNSTDA
FT                   NLEKALGLITKYGTLSDTIGRAIHYGTIARDALAPLPDTVWKSALMEVIDFCIERVN"
     MGVVIPLEES KNKLASIKPL VDLTRADMER VNQLILSKAG SDVQMIPEVA NHLISSGGKR        60
     LRPMLTLASA SLFDYRGENH VKLATSVEFM HTATLLHDDV VDESDLRRGK STARMIWGNQ       120
     ASVLVGDFLL GQAFRMMVDV GSLDALDVLS SAACVIAEGE VLQLSVAKNM ETTEDDYLSV       180
     IRAKTAALFA AAAEVGPIVA EAGRSGRNAL KSYGMNLGLA FQLVDDALDY GGKAADLGKN       240
     VGDDFREGKI TLPVILAYRR GTEDERAFWR DAIEAGNSTD ANLEKALGLI TKYGTLSDTI       300
     GRAIHYGTIA RDALAPLPDT VWKSALMEVI DFCIERVN                               338
//

If you have problems or comments...

PBIL Back to PBIL home page