(data stored in ACNUC7421 zone)

EMBL: CP001622.PE56

CP001622.PE56        Location/Qualifiers
FT   CDS             57506..57943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0057"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000439 putative acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54368"
FT                   /db_xref="GOA:C6AYE4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS54368.1"
FT                   /translation="MMTWTIRPPRAEDQEILAEIYLSVRRETFVWVDPGKFHREDFAAH
FT                   TNGETVFVCAHENGRVAGFLSLWPADDFIHMLYISPEFQGQGAGKALLQALPEWPQHRY
FT                   RLKCLVKNRRAKAFYLSHGFHVTGNGTSPEGDYEELSFFPA"
     MMTWTIRPPR AEDQEILAEI YLSVRRETFV WVDPGKFHRE DFAAHTNGET VFVCAHENGR        60
     VAGFLSLWPA DDFIHMLYIS PEFQGQGAGK ALLQALPEWP QHRYRLKCLV KNRRAKAFYL       120
     SHGFHVTGNG TSPEGDYEEL SFFPA                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page