(data stored in ACNUC7421 zone)

EMBL: CP001622.PE561

CP001622.PE561       Location/Qualifiers
FT   CDS             591169..591939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0569"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG:
FT                   rec:RHECIAT_CH0000967 putative methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54873"
FT                   /db_xref="GOA:C6B2Q3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q3"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ACS54873.1"
FT                   /translation="MTATDTVDAFHRGGFHVVQPKGRGHRSGMDAMLLAALVADDRPVR
FT                   VADLGAGAGAAGLAVASRLANTQVVLFERSAEMADYARRSILLPDNAHLAGRVSVVEAD
FT                   VTLTAKARNDAGLTDESFHHVIMNPPFNDAGDRRTPDALKAEAHAMTDGLFESWIRTAG
FT                   AIIIPGGQLSLIARPQSIAEIVAACGRRFGGIEITAIHPRQGENAVRILVTGIKGSRAR
FT                   LSLRAALIMHEEGSHKFSPLVDDFNNGRAAYARL"
     MTATDTVDAF HRGGFHVVQP KGRGHRSGMD AMLLAALVAD DRPVRVADLG AGAGAAGLAV        60
     ASRLANTQVV LFERSAEMAD YARRSILLPD NAHLAGRVSV VEADVTLTAK ARNDAGLTDE       120
     SFHHVIMNPP FNDAGDRRTP DALKAEAHAM TDGLFESWIR TAGAIIIPGG QLSLIARPQS       180
     IAEIVAACGR RFGGIEITAI HPRQGENAVR ILVTGIKGSR ARLSLRAALI MHEEGSHKFS       240
     PLVDDFNNGR AAYARL                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page