(data stored in ACNUC7421 zone)

EMBL: CP001622.PE562

CP001622.PE562       Location/Qualifiers
FT   CDS             complement(591970..593310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0570"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="TIGRFAM: Mn2+/Fe2+ transporter, NRAMP family; PFAM:
FT                   natural resistance-associated macrophage protein; KEGG:
FT                   ret:RHE_CH00878 manganese transport protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54874"
FT                   /db_xref="GOA:C6B2Q4"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q4"
FT                   /inference="protein motif:TFAM:TIGR01197"
FT                   /protein_id="ACS54874.1"
FT                   /translation="MDALNPNAKNGWRHERGEASLSDVYRTVGTGRHSSRWRRAAAFAG
FT                   PGYMVAVGYMDPGNWATSLAGGSKFGYALLTVALLSNLMAIVLQSLCARLAIASGRDLA
FT                   QACRDAFPKYVSLPLWAFAEIAIIATDIAEVIGTAIGLNLLMGIPLELGVLITALDVFV
FT                   ILFLQKLGFRWVEAFIIALLGVIAVCFGVQILLADPQWGAVLTGFFPTTEIVTNPEMLY
FT                   LALGILGATVMPHNLYLHSGIVQTRAYGHTVPEKREALTFATIDSTVALCFALLINASI
FT                   LILAAAAFNAHGKTDVVELGDAYSLLSPLLGLAIAPTLFGIALLCCGLNSTVTATLAGQ
FT                   IVMEGFLKIRLKPWVRRLITRAIAIVPAAIVTIWYGDQGTAELLILTQVVLSLQLSFAV
FT                   FPLVMFTANKAKMGELVAPRWLSGVAYLIAIVIAGLNVKLLFDFVTG"
     MDALNPNAKN GWRHERGEAS LSDVYRTVGT GRHSSRWRRA AAFAGPGYMV AVGYMDPGNW        60
     ATSLAGGSKF GYALLTVALL SNLMAIVLQS LCARLAIASG RDLAQACRDA FPKYVSLPLW       120
     AFAEIAIIAT DIAEVIGTAI GLNLLMGIPL ELGVLITALD VFVILFLQKL GFRWVEAFII       180
     ALLGVIAVCF GVQILLADPQ WGAVLTGFFP TTEIVTNPEM LYLALGILGA TVMPHNLYLH       240
     SGIVQTRAYG HTVPEKREAL TFATIDSTVA LCFALLINAS ILILAAAAFN AHGKTDVVEL       300
     GDAYSLLSPL LGLAIAPTLF GIALLCCGLN STVTATLAGQ IVMEGFLKIR LKPWVRRLIT       360
     RAIAIVPAAI VTIWYGDQGT AELLILTQVV LSLQLSFAVF PLVMFTANKA KMGELVAPRW       420
     LSGVAYLIAI VIAGLNVKLL FDFVTG                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page