(data stored in ACNUC7421 zone)

EMBL: CP001622.PE563

CP001622.PE563       Location/Qualifiers
FT   CDS             593480..594340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0571"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: ret:RHE_CH00879 protease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54875"
FT                   /db_xref="GOA:C6B2Q5"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q5"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ACS54875.1"
FT                   /translation="MAGFLRKLLPKRFRKDGITIPVVRLQGAIISGGGQFRPTLNLANV
FT                   SPVLEKAFAMKDAPAIAISINSPGGSPVQSRLIFTRIRELAREKQKKVLVFVEDVAASG
FT                   GYMIALAGDEIIADATSIVGSIGVVSGGFGFPELLKKIGVERRVYTAGENKVILDPFQP
FT                   EKEKDIEYLKSLQLEIHQVFISMVRERRASKLRDDATVFSGLFWSGTRGLELGLIDGLG
FT                   DMRQELKRRYGQKTKLELVTAGRGLFGRRIPGVSPVSLEDAASGLATGLVEAAEERALW
FT                   SRFGL"
     MAGFLRKLLP KRFRKDGITI PVVRLQGAII SGGGQFRPTL NLANVSPVLE KAFAMKDAPA        60
     IAISINSPGG SPVQSRLIFT RIRELAREKQ KKVLVFVEDV AASGGYMIAL AGDEIIADAT       120
     SIVGSIGVVS GGFGFPELLK KIGVERRVYT AGENKVILDP FQPEKEKDIE YLKSLQLEIH       180
     QVFISMVRER RASKLRDDAT VFSGLFWSGT RGLELGLIDG LGDMRQELKR RYGQKTKLEL       240
     VTAGRGLFGR RIPGVSPVSL EDAASGLATG LVEAAEERAL WSRFGL                      286
//

If you have problems or comments...

PBIL Back to PBIL home page