(data stored in ACNUC7421 zone)

EMBL: CP001622.PE564

CP001622.PE564       Location/Qualifiers
FT   CDS             594359..594550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54876"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000970"
FT                   /protein_id="ACS54876.1"
FT                   /translation="MPQLITILILVFSAWWLYRRFVSDARKLAEKSRRAEKERQTGAIG
FT                   TLVKDPATGEYRLKREGE"
     MPQLITILIL VFSAWWLYRR FVSDARKLAE KSRRAEKERQ TGAIGTLVKD PATGEYRLKR        60
     EGE                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page