(data stored in ACNUC7421 zone)

EMBL: CP001622.PE565

CP001622.PE565       Location/Qualifiers
FT   CDS             594938..595873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0573"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: ret:RHE_CH00881 glycyl-tRNA synthetase subunit
FT                   alpha; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54877"
FT                   /db_xref="GOA:C6B2Q7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q7"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ACS54877.1"
FT                   /translation="MNPKRSFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLR
FT                   ALGPKPWKAAYVQPSRRPSDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIG
FT                   LDPLLHDIRFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTY
FT                   GLERLAMYVQGVDNVYDLNFNGRDGDEKISYGDVFLQAEQEYSRHNFEFANTEMLHRHF
FT                   VDAEKECRALLDAGAPGDNANQRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSY
FT                   ILRVRTLAKACGEAFLLTDAGGVNLSKEAA"
     MNPKRSFQAL ILTLHNYWAD KGCAVLQPYD MEVGAGTFHP ATTLRALGPK PWKAAYVQPS        60
     RRPSDGRYGE NPNRLQHYYQ YQVILKPNPP NLQELYLGSL AAIGLDPLLH DIRFVEDDWE       120
     SPTLGAWGLG WECWCDGMEV SQFTYFQQVC GIECSPVAGE LTYGLERLAM YVQGVDNVYD       180
     LNFNGRDGDE KISYGDVFLQ AEQEYSRHNF EFANTEMLHR HFVDAEKECR ALLDAGAPGD       240
     NANQRLHKCV FPAYDQCIKA SHVFNLLDAR GVISVTERQS YILRVRTLAK ACGEAFLLTD       300
     AGGVNLSKEA A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page