(data stored in ACNUC7421 zone)

EMBL: CP001622.PE566

CP001622.PE566       Location/Qualifiers
FT   CDS             595968..597791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54878"
FT                   /db_xref="GOA:C6B2Q8"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000973"
FT                   /protein_id="ACS54878.1"
FT                   /translation="MASVSLLKSGILYFKLLYENSAPRMLRLLAWPILCAMLFVLTSCS
FT                   NFDKEFTVYSANTTIEVYTDGSAFVSEHFDILVKKAENYGGVYVDIPQRFTDASGGVHW
FT                   RDFELAAARRDGIDEYYFKENNVPGYSVYIGAEHCKSCSADLLTGVTKIQIAYWLGRLV
FT                   RQEGDHEVLFLPAYMGRVHGQGAKKTLTLKLPPGGTVRPSQQDRAAGYDITRSAPNEIL
FT                   VSIPVGKADRKLPDIEIEYPAGTFVTVTSGERVQWWLSDHFLPFISILGPLIAGLFVLM
FT                   RLGQGWRLPAPSIAGDSKKTESISPALAAYVFWNWKPDTAKAAFMASVCHLATKRLLRI
FT                   SGLGENAEASDLSARQVRKKGKVARARWYGLPAVTRSVFGRIEGERPVNDRRTVVYALY
FT                   GFERDLHQIVAEEYWKVRGGADRAALTTSATILVLGIATAYLSGLLIFSAAICGILLIV
FT                   FLVVTMFRHPERFPVATGTSEQFKQAISLFVGLPAILIVALCYIGTTEVIGEQQPYLVA
FT                   ILLHIAGIIAVLAMLRMPTSKQRQIRNHILSLHRYFHGEIDGPPMSIECYEHHLPFAVA
FT                   LGVEQRWTERFNLWRESEKMDAYAPDWRISS"
     MASVSLLKSG ILYFKLLYEN SAPRMLRLLA WPILCAMLFV LTSCSNFDKE FTVYSANTTI        60
     EVYTDGSAFV SEHFDILVKK AENYGGVYVD IPQRFTDASG GVHWRDFELA AARRDGIDEY       120
     YFKENNVPGY SVYIGAEHCK SCSADLLTGV TKIQIAYWLG RLVRQEGDHE VLFLPAYMGR       180
     VHGQGAKKTL TLKLPPGGTV RPSQQDRAAG YDITRSAPNE ILVSIPVGKA DRKLPDIEIE       240
     YPAGTFVTVT SGERVQWWLS DHFLPFISIL GPLIAGLFVL MRLGQGWRLP APSIAGDSKK       300
     TESISPALAA YVFWNWKPDT AKAAFMASVC HLATKRLLRI SGLGENAEAS DLSARQVRKK       360
     GKVARARWYG LPAVTRSVFG RIEGERPVND RRTVVYALYG FERDLHQIVA EEYWKVRGGA       420
     DRAALTTSAT ILVLGIATAY LSGLLIFSAA ICGILLIVFL VVTMFRHPER FPVATGTSEQ       480
     FKQAISLFVG LPAILIVALC YIGTTEVIGE QQPYLVAILL HIAGIIAVLA MLRMPTSKQR       540
     QIRNHILSLH RYFHGEIDGP PMSIECYEHH LPFAVALGVE QRWTERFNLW RESEKMDAYA       600
     PDWRISS                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page