(data stored in ACNUC7421 zone)

EMBL: CP001622.PE567

CP001622.PE567       Location/Qualifiers
FT   CDS             597906..598457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0575"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG:
FT                   rec:RHECIAT_CH0000974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54879"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q9"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ACS54879.1"
FT                   /translation="MYVILAIIVVIALYLVFIYNGLVRARQMAEEAWSGIDVQLKRRAD
FT                   LIPNLIETVKGYAAHEKSTLEEVVELRNKAQAVPSGDVAGRAQAEGLLGQALGRVIALA
FT                   EAYPDLKANQNFAELQASLETMEGELQMARRYYNGAARDLNVKVESFPSNLVAGQFGFA
FT                   KREYFEITNEADRAVPTVKF"
     MYVILAIIVV IALYLVFIYN GLVRARQMAE EAWSGIDVQL KRRADLIPNL IETVKGYAAH        60
     EKSTLEEVVE LRNKAQAVPS GDVAGRAQAE GLLGQALGRV IALAEAYPDL KANQNFAELQ       120
     ASLETMEGEL QMARRYYNGA ARDLNVKVES FPSNLVAGQF GFAKREYFEI TNEADRAVPT       180
     VKF                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page