(data stored in ACNUC7421 zone)

EMBL: CP001622.PE568

CP001622.PE568       Location/Qualifiers
FT   CDS             598618..599880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0576"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="KEGG: rec:RHECIAT_CH0000975 3-phosphoshikimate
FT                   1-carboxyvinyltransferase protein; TIGRFAM:
FT                   3-phosphoshikimate 1-carboxyvinyltransferase; PFAM: EPSP
FT                   synthase (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54880"
FT                   /db_xref="GOA:C6B2R0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2R0"
FT                   /inference="protein motif:TFAM:TIGR01356"
FT                   /protein_id="ACS54880.1"
FT                   /translation="MTRTAKLTIIPPGRPLSGRAMPPGSKSITNRALLLAGLAKGTSRL
FT                   TGALKSDDTRYMAEALRAMGVTIDEPDDTTFVVTGSGRLLPPKAPLFLGNAGTATRFLT
FT                   AAAALVDGTVIVDGDEHMRKRPIGPLVEAMRTLGIDVSAETGCPPVTVKGTGRFQADRI
FT                   RIDGGLSSQYVSALLMMAAGGDRPIDIELVGEDIGALGYIDLTTAAMKAFGAKVEKTSP
FT                   VTWRVEPTGYHAADFIVEPDASAATYLWAAEVLTGGAIDLGVPSDAFSQPDARAYDMIA
FT                   KFPHLPSEIDGSQMQDAVPTLAVLAAFNETPVRFVGIANLRVKECDRIQALSTGLNRIV
FT                   SGLAREEGDDLIVQSDPALVGQHLPAEIDSFADHRIAMSFALAGLKIDGITILDPDCVG
FT                   KTFPAYWRTLAALGVTYQDKD"
     MTRTAKLTII PPGRPLSGRA MPPGSKSITN RALLLAGLAK GTSRLTGALK SDDTRYMAEA        60
     LRAMGVTIDE PDDTTFVVTG SGRLLPPKAP LFLGNAGTAT RFLTAAAALV DGTVIVDGDE       120
     HMRKRPIGPL VEAMRTLGID VSAETGCPPV TVKGTGRFQA DRIRIDGGLS SQYVSALLMM       180
     AAGGDRPIDI ELVGEDIGAL GYIDLTTAAM KAFGAKVEKT SPVTWRVEPT GYHAADFIVE       240
     PDASAATYLW AAEVLTGGAI DLGVPSDAFS QPDARAYDMI AKFPHLPSEI DGSQMQDAVP       300
     TLAVLAAFNE TPVRFVGIAN LRVKECDRIQ ALSTGLNRIV SGLAREEGDD LIVQSDPALV       360
     GQHLPAEIDS FADHRIAMSF ALAGLKIDGI TILDPDCVGK TFPAYWRTLA ALGVTYQDKD       420
//

If you have problems or comments...

PBIL Back to PBIL home page