(data stored in ACNUC7421 zone)

EMBL: CP001622.PE569

CP001622.PE569       Location/Qualifiers
FT   CDS             599919..601853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54881"
FT                   /db_xref="GOA:C6B2R1"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2R1"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00885"
FT                   /protein_id="ACS54881.1"
FT                   /translation="MGRRFFGFCFALLLMLAAPAAFAAEVIDSFASDITLEKSGAMTVT
FT                   ETITVNAEGNQINHGIFRDFPLYFTDAAGRRRSVDFDMVSVQRDGDNEPWHTESISGGI
FT                   RIYAGSADVTVTPGRHRYVFTYRTNRQIRYFDDHDELYWNVTGNGWIFPIRSATATVKL
FT                   PPDVGATETTFFTGPEGATGKNARVSESGAGLVFSTTAPLDAYEGLTFAIRMPKGSIDP
FT                   PSADMESTWWLKDNRNYFIGFGGLLLVLAYYTRSWLKVGRDPARGVVVPRWDAPDGISP
FT                   ALVNYIDNKGFSGEGWTALSATALNLAVRGYVKLEDLKNSIVIQGTGKPLGKEKFQAGE
FT                   IELLKVAGGAGSTLTIDKANGERVKSVGQAFRSAIEKEHRGKYYNSNLGYTAGGIVLSA
FT                   AALVILFVFGSLAPDTIALMLIPIAISVFVAVFAAGLVRSLHRGKSLFGKIIAIISAAI
FT                   GVFVGISILATMVLALASSLVELHETPMLFAVGGIVLLNILYVFIMGAPTPLGAKMMDG
FT                   IDGLRQYLTLAEKDRMNTAGAPEMSPRHFETLLPYAVALGVEKPWSRTFETWLAAAAAG
FT                   AAAAYAPAWYAGNFNSGSFSDRIGGFSSSMASTIASTIPAPPPSSSSSGFSGGGSSGGG
FT                   GGGGGGGGW"
     MGRRFFGFCF ALLLMLAAPA AFAAEVIDSF ASDITLEKSG AMTVTETITV NAEGNQINHG        60
     IFRDFPLYFT DAAGRRRSVD FDMVSVQRDG DNEPWHTESI SGGIRIYAGS ADVTVTPGRH       120
     RYVFTYRTNR QIRYFDDHDE LYWNVTGNGW IFPIRSATAT VKLPPDVGAT ETTFFTGPEG       180
     ATGKNARVSE SGAGLVFSTT APLDAYEGLT FAIRMPKGSI DPPSADMEST WWLKDNRNYF       240
     IGFGGLLLVL AYYTRSWLKV GRDPARGVVV PRWDAPDGIS PALVNYIDNK GFSGEGWTAL       300
     SATALNLAVR GYVKLEDLKN SIVIQGTGKP LGKEKFQAGE IELLKVAGGA GSTLTIDKAN       360
     GERVKSVGQA FRSAIEKEHR GKYYNSNLGY TAGGIVLSAA ALVILFVFGS LAPDTIALML       420
     IPIAISVFVA VFAAGLVRSL HRGKSLFGKI IAIISAAIGV FVGISILATM VLALASSLVE       480
     LHETPMLFAV GGIVLLNILY VFIMGAPTPL GAKMMDGIDG LRQYLTLAEK DRMNTAGAPE       540
     MSPRHFETLL PYAVALGVEK PWSRTFETWL AAAAAGAAAA YAPAWYAGNF NSGSFSDRIG       600
     GFSSSMASTI ASTIPAPPPS SSSSGFSGGG SSGGGGGGGG GGGW                        644
//

If you have problems or comments...

PBIL Back to PBIL home page