(data stored in ACNUC7421 zone)

EMBL: CP001622.PE57

CP001622.PE57        Location/Qualifiers
FT   CDS             complement(57996..58328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54369"
FT                   /db_xref="GOA:C6AYE5"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE5"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00398"
FT                   /protein_id="ACS54369.1"
FT                   /translation="MAKKIVNLLILLPLGVILIVFCVANRQSVTLAFNPFRPDDQVLAV
FT                   SAPFFVFLVVVLIAGMLIGAAATWFSQGKHRRRARTEAKEAIRWQSEADRHKNRAEEIA
FT                   GQLPAR"
     MAKKIVNLLI LLPLGVILIV FCVANRQSVT LAFNPFRPDD QVLAVSAPFF VFLVVVLIAG        60
     MLIGAAATWF SQGKHRRRAR TEAKEAIRWQ SEADRHKNRA EEIAGQLPAR                  110
//

If you have problems or comments...

PBIL Back to PBIL home page