(data stored in ACNUC7421 zone)

EMBL: CP001622.PE570

CP001622.PE570       Location/Qualifiers
FT   CDS             601919..603196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0578"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: rec:RHECIAT_CH0000977
FT                   phosphoribosylamine-glycine ligase protein; TIGRFAM:
FT                   phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54882"
FT                   /db_xref="GOA:C6B3G1"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G1"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ACS54882.1"
FT                   /translation="MKVLLIGSGGREHALAWKLAQSPLMSEFYAAPGNPGIAEHAVLVP
FT                   VDIEDHEAVVAFCKDKAIDFVVVGPEAPLVAGLADRLRADGLAVFGPSAAAAQLEGSKG
FT                   FTKDICARYGIPTGAYQRFNNGPKAKAYIRAEGVPIVVKADGLAAGKGVTVAMTLDEAL
FT                   AAVDDCFEGAFGAAGAEVVVEAYLDGEEASFFCLCDGKHALPLATAQDHKRVGEGDTGV
FT                   NTGGMGAYSPAPVMTAEMVERTMKEIIEPTMRGMAESGHPFSGVFFAGLMITKKGPELI
FT                   EYNVRFGDPECQVMMMRLKSDLLPLLLATANGTLDQVKAEWNEDPALTVVMASKGYPGA
FT                   YDKNTPILSLPDAGKGEKVFHAGTGLKDGALVATGGRVLNVTASGGTVAEAKSRAYALL
FT                   DRVRWENGFCRRDIGWRAIEREMGSE"
     MKVLLIGSGG REHALAWKLA QSPLMSEFYA APGNPGIAEH AVLVPVDIED HEAVVAFCKD        60
     KAIDFVVVGP EAPLVAGLAD RLRADGLAVF GPSAAAAQLE GSKGFTKDIC ARYGIPTGAY       120
     QRFNNGPKAK AYIRAEGVPI VVKADGLAAG KGVTVAMTLD EALAAVDDCF EGAFGAAGAE       180
     VVVEAYLDGE EASFFCLCDG KHALPLATAQ DHKRVGEGDT GVNTGGMGAY SPAPVMTAEM       240
     VERTMKEIIE PTMRGMAESG HPFSGVFFAG LMITKKGPEL IEYNVRFGDP ECQVMMMRLK       300
     SDLLPLLLAT ANGTLDQVKA EWNEDPALTV VMASKGYPGA YDKNTPILSL PDAGKGEKVF       360
     HAGTGLKDGA LVATGGRVLN VTASGGTVAE AKSRAYALLD RVRWENGFCR RDIGWRAIER       420
     EMGSE                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page