(data stored in ACNUC7421 zone)

EMBL: CP001622.PE571

CP001622.PE571       Location/Qualifiers
FT   CDS             603296..603757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54883"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000978"
FT                   /protein_id="ACS54883.1"
FT                   /translation="MRQIFLGAAILLMAGPVMASSIEVVGKTAPRAESSIVTESCAHCP
FT                   PLQAELTKKDYTVPELKPGVLQASEVRDVGGEKKIYRTEGWMGGSPVVFVSKATPESMI
FT                   AAAPPAAPVDGIDMNATTAAVIGDDARPVEAGMTEQPAALNASEFKLRF"
     MRQIFLGAAI LLMAGPVMAS SIEVVGKTAP RAESSIVTES CAHCPPLQAE LTKKDYTVPE        60
     LKPGVLQASE VRDVGGEKKI YRTEGWMGGS PVVFVSKATP ESMIAAAPPA APVDGIDMNA       120
     TTAAVIGDDA RPVEAGMTEQ PAALNASEFK LRF                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page