(data stored in ACNUC7421 zone)

EMBL: CP001622.PE572

CP001622.PE572       Location/Qualifiers
FT   CDS             604186..606006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0580"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; KEGG: ret:RHE_CH00888
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54884"
FT                   /db_xref="GOA:C6B3G3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G3"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54884.1"
FT                   /translation="MKKLKIAHQLFALIGVLMAAFAVATYFEIRTSEQAIYDERFDMLR
FT                   TQVESGISVLNTFYEREKAGQMTHEAAQTEAFEILKRVSFQPSGYLFGFDYNVVQLFHP
FT                   SPVNLGKDMSGQVDKTGAKFSQALVDNGKAGGGRTFYYWTKPGQPEDQVFLKGGYSKAF
FT                   EPWKIVVGTGVYLDDLQQKVNATIWKALTASLIVFVCGIAAAVFFIRGISHPLKDIHNA
FT                   LQSVAEEDVSISIPHTGMNNEVGMMAKATQSLQEKIRERHAMSDREAAQQLALESEREN
FT                   NLRQQQDETTLQARVVATIGQALEMIARGDLTVRCADLGQKYAALRDNFNDALSHLEAA
FT                   MAKVSAKGTDIGTSKEEIRRASNELSQRTERQAASLEETSAALDELTVAVRQTADGAHE
FT                   ASKRVHSVSTEATHSDAIVTQAIEAMSGIEKSSSEITKIIGVIDEIAFQTNLLALNAGV
FT                   EAARAGESGKGFAVVAQEVRELAQRSAAAAKEIKDQIARSSSQVDHGVRLVGEAGEALK
FT                   RISDQIKAANEIVAKIAHSASEQDTTLRSISSSMNQLDAATQQNAAMAEETTASAETLA
FT                   TDTDELIDLIRGFRVSAPQHRQAEPMRRAS"
     MKKLKIAHQL FALIGVLMAA FAVATYFEIR TSEQAIYDER FDMLRTQVES GISVLNTFYE        60
     REKAGQMTHE AAQTEAFEIL KRVSFQPSGY LFGFDYNVVQ LFHPSPVNLG KDMSGQVDKT       120
     GAKFSQALVD NGKAGGGRTF YYWTKPGQPE DQVFLKGGYS KAFEPWKIVV GTGVYLDDLQ       180
     QKVNATIWKA LTASLIVFVC GIAAAVFFIR GISHPLKDIH NALQSVAEED VSISIPHTGM       240
     NNEVGMMAKA TQSLQEKIRE RHAMSDREAA QQLALESERE NNLRQQQDET TLQARVVATI       300
     GQALEMIARG DLTVRCADLG QKYAALRDNF NDALSHLEAA MAKVSAKGTD IGTSKEEIRR       360
     ASNELSQRTE RQAASLEETS AALDELTVAV RQTADGAHEA SKRVHSVSTE ATHSDAIVTQ       420
     AIEAMSGIEK SSSEITKIIG VIDEIAFQTN LLALNAGVEA ARAGESGKGF AVVAQEVREL       480
     AQRSAAAAKE IKDQIARSSS QVDHGVRLVG EAGEALKRIS DQIKAANEIV AKIAHSASEQ       540
     DTTLRSISSS MNQLDAATQQ NAAMAEETTA SAETLATDTD ELIDLIRGFR VSAPQHRQAE       600
     PMRRAS                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page