(data stored in ACNUC7421 zone)

EMBL: CP001622.PE573

CP001622.PE573       Location/Qualifiers
FT   CDS             606268..608091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0581"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; KEGG: ret:RHE_CH00888
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54885"
FT                   /db_xref="GOA:C6B3G4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54885.1"
FT                   /translation="MKNLKISKQLILLVVGLMVAFAIATSLQIRSSVNAIYNERYDMLR
FT                   AEVQSAVSVLKIYQAKVTAGEMTLEDAQKQAYATVNAMKYDPDGYFFGYSYDIQMMFHY
FT                   DAAKIGQVNKGQPDSKGKLYREELVKLGQQGGGLVEYYSTAKPGQPAGDFRKTAYAQAF
FT                   DPWKVVVVTGVYMDDLDAQINSTILTALSGSIVLFFLAMAAAYVVIRGISGPLNNVHAA
FT                   LKAVAEEDVSIAIPHTGMNNEVGMMAKATQSLQEKIRERHAMSDREAAQQLALESEREN
FT                   NLRQQQDEATLQARVVTTIGQALEMIARGDLTVRCADLGQKYAALRDNFNDALSHLEAA
FT                   MAKVSAKGTDIGTSKEEIRRASNELSQRTERQAASLEETSAALDELTVAVRQTADGAHE
FT                   ASKRVHSVSTEATHSDAIVTQAIEAMSGIEKSSSEITKIIGVIDEIAFQTNLLALNAGV
FT                   EAARAGESGKGFAVVAQEVRELAQRSAAAAKEIKDQIARSSSQVDHGVRLVGEAGEALK
FT                   RISDQIKAANEIVAKIAHSASEQDTTLRSISSSMNQLDAATQQNAAMAEETTASAETLA
FT                   TDTDELIDLIRGFRVSGESAAPAMHQGRRAA"
     MKNLKISKQL ILLVVGLMVA FAIATSLQIR SSVNAIYNER YDMLRAEVQS AVSVLKIYQA        60
     KVTAGEMTLE DAQKQAYATV NAMKYDPDGY FFGYSYDIQM MFHYDAAKIG QVNKGQPDSK       120
     GKLYREELVK LGQQGGGLVE YYSTAKPGQP AGDFRKTAYA QAFDPWKVVV VTGVYMDDLD       180
     AQINSTILTA LSGSIVLFFL AMAAAYVVIR GISGPLNNVH AALKAVAEED VSIAIPHTGM       240
     NNEVGMMAKA TQSLQEKIRE RHAMSDREAA QQLALESERE NNLRQQQDEA TLQARVVTTI       300
     GQALEMIARG DLTVRCADLG QKYAALRDNF NDALSHLEAA MAKVSAKGTD IGTSKEEIRR       360
     ASNELSQRTE RQAASLEETS AALDELTVAV RQTADGAHEA SKRVHSVSTE ATHSDAIVTQ       420
     AIEAMSGIEK SSSEITKIIG VIDEIAFQTN LLALNAGVEA ARAGESGKGF AVVAQEVREL       480
     AQRSAAAAKE IKDQIARSSS QVDHGVRLVG EAGEALKRIS DQIKAANEIV AKIAHSASEQ       540
     DTTLRSISSS MNQLDAATQQ NAAMAEETTA SAETLATDTD ELIDLIRGFR VSGESAAPAM       600
     HQGRRAA                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page