(data stored in ACNUC7421 zone)

EMBL: CP001622.PE574

CP001622.PE574       Location/Qualifiers
FT   CDS             complement(608170..608658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0582"
FT                   /product="protein of unknown function DUF523"
FT                   /note="PFAM: protein of unknown function DUF523; KEGG:
FT                   rec:RHECIAT_CH0000979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54886"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G5"
FT                   /inference="protein motif:PFAM:PF04463"
FT                   /protein_id="ACS54886.1"
FT                   /translation="MQSKILVSACLMGQAVRYDGRAKPLLHPVIETWRAEGRLVTICPE
FT                   MSAGMTVPRPPAEIAEAATGEDVLAGTARVVELTGADVTEEFLLAAENAVALARQAGCH
FT                   YALLIDGSPSCGSGFIYDGTFSGRKEAGNGVTAAALKAAGVEVFSDREIERLIERIGQ"
     MQSKILVSAC LMGQAVRYDG RAKPLLHPVI ETWRAEGRLV TICPEMSAGM TVPRPPAEIA        60
     EAATGEDVLA GTARVVELTG ADVTEEFLLA AENAVALARQ AGCHYALLID GSPSCGSGFI       120
     YDGTFSGRKE AGNGVTAAAL KAAGVEVFSD REIERLIERI GQ                          162
//

If you have problems or comments...

PBIL Back to PBIL home page