(data stored in ACNUC7421 zone)

EMBL: CP001622.PE575

CP001622.PE575       Location/Qualifiers
FT   CDS             complement(608717..610831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0583"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: rec:RHECIAT_CH0000980 glycyl-tRNA synthetase
FT                   protein, beta subunit; TIGRFAM: glycyl-tRNA synthetase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54887"
FT                   /db_xref="GOA:C6B3G6"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G6"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ACS54887.1"
FT                   /translation="MPNLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLSYEGARE
FT                   YWTPRRLALDIHGLTARSADVREERKGPRTDANEKAIEGFLRGAGLSSVSEAQVVSDPK
FT                   KGDFYVAVISKPGRATEEIVSDVMPGIIRDFPWPKSMRWGKASSKPGALRWVRPLQSIV
FT                   CTFGPEHEETTVIPFEIDGITASNITYGHRFHAPEAITVRRFDDYAANLEKAKVILDAE
FT                   RRKDIILHDARDIAFANGLELVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIPSEIIRL
FT                   TIKTNQKCFVTRPQGGETLSNKFILVSNIQASDGGKEIVHGNGKVVRARLSDALHFWKR
FT                   DQGNLPDLETLEASAAKFGLDLKKPLDQRMAKLDALDVTFHAKLGTQGARVARIRTLAK
FT                   ELADITGADAALIDRAAVLAKADLRTEAVGEFPELQGLMGRKYAVLQGEDASVAAAIED
FT                   HYKPQGPSDRVPEDRVAITIALADKLDTLIGFWAIDEKPTGSKDPFALRRAALGVVRIL
FT                   LERRIRLPLLATTKDGDLLSFFHDRLKVYLRDQGARHDLIDAVLTSDADDLLMVARRVE
FT                   ALTAFITSEDGKNLLSGTKRATQLLAAEEKKGTVIADGVSPALLTLDAEKELFAAISGA
FT                   SKDASDAVAGEDFRSAMEALSKLRGPVDRFFEDVLVNDEDAAIRANRLALLRLIREATG
FT                   TVADFSKISG"
     MPNLLLELRS EEIPARMQRK AAGDLKKLVT DALVEAGLSY EGAREYWTPR RLALDIHGLT        60
     ARSADVREER KGPRTDANEK AIEGFLRGAG LSSVSEAQVV SDPKKGDFYV AVISKPGRAT       120
     EEIVSDVMPG IIRDFPWPKS MRWGKASSKP GALRWVRPLQ SIVCTFGPEH EETTVIPFEI       180
     DGITASNITY GHRFHAPEAI TVRRFDDYAA NLEKAKVILD AERRKDIILH DARDIAFANG       240
     LELVEDEGLL EEVSGLVEWP QVLMGSFEED YLSIPSEIIR LTIKTNQKCF VTRPQGGETL       300
     SNKFILVSNI QASDGGKEIV HGNGKVVRAR LSDALHFWKR DQGNLPDLET LEASAAKFGL       360
     DLKKPLDQRM AKLDALDVTF HAKLGTQGAR VARIRTLAKE LADITGADAA LIDRAAVLAK       420
     ADLRTEAVGE FPELQGLMGR KYAVLQGEDA SVAAAIEDHY KPQGPSDRVP EDRVAITIAL       480
     ADKLDTLIGF WAIDEKPTGS KDPFALRRAA LGVVRILLER RIRLPLLATT KDGDLLSFFH       540
     DRLKVYLRDQ GARHDLIDAV LTSDADDLLM VARRVEALTA FITSEDGKNL LSGTKRATQL       600
     LAAEEKKGTV IADGVSPALL TLDAEKELFA AISGASKDAS DAVAGEDFRS AMEALSKLRG       660
     PVDRFFEDVL VNDEDAAIRA NRLALLRLIR EATGTVADFS KISG                        704
//

If you have problems or comments...

PBIL Back to PBIL home page