(data stored in ACNUC7421 zone)

EMBL: CP001622.PE576

CP001622.PE576       Location/Qualifiers
FT   CDS             611051..613360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0584"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; RNA binding S1
FT                   domain protein; KEGG: rec:RHECIAT_CH0000981 probable
FT                   transcriptional accessory protein (RNA binding S1 domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54888"
FT                   /db_xref="GOA:C6B3G7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G7"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACS54888.1"
FT                   /translation="MAADLRFLAARISAEINARPEQAKAAIELLDEGSTVPFIARYRKE
FT                   VTGGLDDTQLRNLAERLVYLRELEARRDAIVESITGQGKMTDELMTKVAGAETKAELED
FT                   LYLPYKPKRRTRAEIARERGLGPLAETILADRAREPAVLAEGFVTADVPDVKTALEGAR
FT                   DIIAEGIAENADLLGRLRAHMRQAALLKAKVVDGKQATGEKFSDYFDHSERWATAPGHR
FT                   ALAMLRGWNEEVLTLTIEADAETTSPNKPVERMIVAAYEIGTSRPGDRWLMEVASWTWR
FT                   VKLSMSLSLDLMRELRERAEEEAIHVFARNLKDLLLAAPAGSRATMGLDPGIRTGVKVA
FT                   VVDGTGKVVATSTVYPFQPRNDVRGAQVELASLIRKHNVELISIGNGTGSRETEKLVAD
FT                   MLAELPAPKPTKVIVSEAGASVYSASATAAAEFPDLDVSLRGAVSIARRLQDPLAELVK
FT                   IEPKSIGVGQYQHDVDQQKLSRSLDAVVEDAVNAVGVDLNTASAPLLSRVSGLGPSIAD
FT                   AIVRHRDSEGRFETRKDLLKVARLGGRTFEQCAGFLRIPNGKEPLDSSSVHPEAYGVAK
FT                   KIVAACGRDLRALMGDSAVLKSVDPRQFIDEKFGLPTVRDIIAELEKPGRDPRPSFKTA
FT                   TFAEGVNEISDLKPGMVLEGTVTNVAAFGAFVDIGVHQDGLVHVSQLADRFVKDPHEVV
FT                   KAGDVVKVRVVEVDAKRKRIALSMKRDDGSSAPPPRGDSRANQGSRPQNESRPAAAKPE
FT                   SQGAFGAALAEAMKRK"
     MAADLRFLAA RISAEINARP EQAKAAIELL DEGSTVPFIA RYRKEVTGGL DDTQLRNLAE        60
     RLVYLRELEA RRDAIVESIT GQGKMTDELM TKVAGAETKA ELEDLYLPYK PKRRTRAEIA       120
     RERGLGPLAE TILADRAREP AVLAEGFVTA DVPDVKTALE GARDIIAEGI AENADLLGRL       180
     RAHMRQAALL KAKVVDGKQA TGEKFSDYFD HSERWATAPG HRALAMLRGW NEEVLTLTIE       240
     ADAETTSPNK PVERMIVAAY EIGTSRPGDR WLMEVASWTW RVKLSMSLSL DLMRELRERA       300
     EEEAIHVFAR NLKDLLLAAP AGSRATMGLD PGIRTGVKVA VVDGTGKVVA TSTVYPFQPR       360
     NDVRGAQVEL ASLIRKHNVE LISIGNGTGS RETEKLVADM LAELPAPKPT KVIVSEAGAS       420
     VYSASATAAA EFPDLDVSLR GAVSIARRLQ DPLAELVKIE PKSIGVGQYQ HDVDQQKLSR       480
     SLDAVVEDAV NAVGVDLNTA SAPLLSRVSG LGPSIADAIV RHRDSEGRFE TRKDLLKVAR       540
     LGGRTFEQCA GFLRIPNGKE PLDSSSVHPE AYGVAKKIVA ACGRDLRALM GDSAVLKSVD       600
     PRQFIDEKFG LPTVRDIIAE LEKPGRDPRP SFKTATFAEG VNEISDLKPG MVLEGTVTNV       660
     AAFGAFVDIG VHQDGLVHVS QLADRFVKDP HEVVKAGDVV KVRVVEVDAK RKRIALSMKR       720
     DDGSSAPPPR GDSRANQGSR PQNESRPAAA KPESQGAFGA ALAEAMKRK                   769
//

If you have problems or comments...

PBIL Back to PBIL home page