(data stored in ACNUC7421 zone)

EMBL: CP001622.PE577

CP001622.PE577       Location/Qualifiers
FT   CDS             613494..614753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0585"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ret:RHE_CH00892 cyclopropane-fatty-acyl-phospholipid
FT                   synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54889"
FT                   /db_xref="GOA:C6B3G8"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G8"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ACS54889.1"
FT                   /translation="MASAFLSIVEKIIRKGSLKLTIANGETHTIGDGTGETVVARLADQ
FT                   EAEDAIRRDPAMKLGEMYMQGRFILEQGNIYDFLSLVKQNTTNEIFDFKMAALLLGRIA
FT                   KQQLKSRVPVNRNKHNVAHHYDLSAKLFDLFLDEDWQYSCAYFEPPGIGLDEAQLAKKR
FT                   HIAAKLLLEPNQRILEIGSGWGGMGMYLTEATDGAEFTGITLSEEQLKVSRTRAEKRGL
FT                   ADRVRFELQDYRTMTGRKFDRIVSVGMFEHVGIGHYGNFFRKVSDLLDDNGVMVLHSIG
FT                   RPKPSFGTNAFIEKYIFPGGYIPSVGEVVPPLEKAGLLVKDIEILPLHYAYTLRHWRER
FT                   FVARKAEAVALYDEQFFRMWEFYLAGSEIGFRWDELFILQIQIAKNQFAVPDNRNYIAR
FT                   NEAKLKEFEAGRAPLEKVTF"
     MASAFLSIVE KIIRKGSLKL TIANGETHTI GDGTGETVVA RLADQEAEDA IRRDPAMKLG        60
     EMYMQGRFIL EQGNIYDFLS LVKQNTTNEI FDFKMAALLL GRIAKQQLKS RVPVNRNKHN       120
     VAHHYDLSAK LFDLFLDEDW QYSCAYFEPP GIGLDEAQLA KKRHIAAKLL LEPNQRILEI       180
     GSGWGGMGMY LTEATDGAEF TGITLSEEQL KVSRTRAEKR GLADRVRFEL QDYRTMTGRK       240
     FDRIVSVGMF EHVGIGHYGN FFRKVSDLLD DNGVMVLHSI GRPKPSFGTN AFIEKYIFPG       300
     GYIPSVGEVV PPLEKAGLLV KDIEILPLHY AYTLRHWRER FVARKAEAVA LYDEQFFRMW       360
     EFYLAGSEIG FRWDELFILQ IQIAKNQFAV PDNRNYIARN EAKLKEFEAG RAPLEKVTF        419
//

If you have problems or comments...

PBIL Back to PBIL home page