(data stored in ACNUC7421 zone)

EMBL: CP001622.PE58

CP001622.PE58        Location/Qualifiers
FT   CDS             complement(58490..58789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0059"
FT                   /product="integration host factor, beta subunit"
FT                   /note="KEGG: rec:RHECIAT_CH0000441 integration host factor
FT                   beta-subunit protein; TIGRFAM: integration host factor,
FT                   beta subunit; PFAM: histone family protein DNA-binding
FT                   protein; SMART: histone family protein DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54370"
FT                   /db_xref="GOA:C6AYE6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE6"
FT                   /inference="protein motif:TFAM:TIGR00988"
FT                   /protein_id="ACS54370.1"
FT                   /translation="MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVEL
FT                   RGFGAFSVKNRPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGQADEED"
     MIKSELVQIV AARNPHLYHR DVENIVNAVL DEITDALAAG NRVELRGFGA FSVKNRPSRS        60
     GRNPRTGDTV FVEEKWVPFF KTGKELRERL NPGQADEED                               99
//

If you have problems or comments...

PBIL Back to PBIL home page