(data stored in ACNUC7421 zone)

EMBL: CP001622.PE59

CP001622.PE59        Location/Qualifiers
FT   CDS             complement(58819..59769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0060"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S49; KEGG: rec:RHECIAT_CH0000442 proteinase
FT                   IV protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54371"
FT                   /db_xref="GOA:C6AYE7"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE7"
FT                   /inference="protein motif:TFAM:TIGR00706"
FT                   /protein_id="ACS54371.1"
FT                   /translation="MDSSIIADRRRLRRKLGFWRVIAVALIVALGFAFYRFALGDAGTE
FT                   RPHIAHVTISGLIVDDDELLERLKKVEISDQVKAVVISISSPGGTTYGGEKIFKAIRAI
FT                   SAKKPVVSDVRTLAASAGYMIATAGDTIIAGDSSITGSIGVIFQYPQIQPLLDKIGVSL
FT                   QEIKSSPLKAEPSPFHEASEEAKAMIRNMVVDSYNWFVDLVADRRKLPRDEVLKLADGT
FT                   IYTGRQALKVKLVDAIGGEAEIRAYLTSRGVDSDLPMVDWDKKSNTPFLLAGAVSRLIT
FT                   IFGYDDLMKTQDINGILPPKLLLDGLLSVWQVGHD"
     MDSSIIADRR RLRRKLGFWR VIAVALIVAL GFAFYRFALG DAGTERPHIA HVTISGLIVD        60
     DDELLERLKK VEISDQVKAV VISISSPGGT TYGGEKIFKA IRAISAKKPV VSDVRTLAAS       120
     AGYMIATAGD TIIAGDSSIT GSIGVIFQYP QIQPLLDKIG VSLQEIKSSP LKAEPSPFHE       180
     ASEEAKAMIR NMVVDSYNWF VDLVADRRKL PRDEVLKLAD GTIYTGRQAL KVKLVDAIGG       240
     EAEIRAYLTS RGVDSDLPMV DWDKKSNTPF LLAGAVSRLI TIFGYDDLMK TQDINGILPP       300
     KLLLDGLLSV WQVGHD                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page