(data stored in ACNUC7421 zone)

EMBL: CP001622.PE6

CP001622.PE6         Location/Qualifiers
FT   CDS             complement(5172..5891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0006"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: rec:RHECIAT_CH0000402 ribonuclease PH protein;
FT                   TIGRFAM: ribonuclease PH; PFAM: 3' exoribonuclease;
FT                   Exoribonuclease, phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54318"
FT                   /db_xref="GOA:C6AY94"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY94"
FT                   /inference="protein motif:TFAM:TIGR01966"
FT                   /protein_id="ACS54318.1"
FT                   /translation="MRPSGRKIDQMRKVSFERNFSKHAEGSCLVKFGDTHVLCTASLEE
FT                   KTPPWLRNTGKGWVTAEYGMLPRATGERMKREAAAGKQGGRTQEIQRLIGRSLRAVVDL
FT                   QALGERQITLDCDVIQADGGTRTASITGGWIALYDCLKWMESRNMIKVERVLKDHVAAI
FT                   SCGIFASQPVIDLDYIEDSSAETDANFVMTGTGGIVEIQGTAEGTPFSEGEFTSLMQLA
FT                   RNGIGELVALQKQAVEG"
     MRPSGRKIDQ MRKVSFERNF SKHAEGSCLV KFGDTHVLCT ASLEEKTPPW LRNTGKGWVT        60
     AEYGMLPRAT GERMKREAAA GKQGGRTQEI QRLIGRSLRA VVDLQALGER QITLDCDVIQ       120
     ADGGTRTASI TGGWIALYDC LKWMESRNMI KVERVLKDHV AAISCGIFAS QPVIDLDYIE       180
     DSSAETDANF VMTGTGGIVE IQGTAEGTPF SEGEFTSLMQ LARNGIGELV ALQKQAVEG        239
//

If you have problems or comments...

PBIL Back to PBIL home page