(data stored in ACNUC7421 zone)

EMBL: CP001622.PE60

CP001622.PE60        Location/Qualifiers
FT   CDS             59995..60660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0061"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   rec:RHECIAT_CH0000443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54372"
FT                   /db_xref="GOA:C6AYE8"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE8"
FT                   /inference="protein motif:PFAM:PF06835"
FT                   /protein_id="ACS54372.1"
FT                   /translation="MLDTLKNNGHAAYSGSGKNAYGDALFHSARVRRLKILLPVAALIV
FT                   AASLTAVALVSIYLPENIKMEGAKIENGKVVMEKPAISGRNSDGINYSMLAERALQDIR
FT                   NPDLITLETIKAAVPMNDGLIARVVASTADYNRATDNLHMTAPFTLVLSSGLNANFQSA
FT                   QLDIKGGNMRSDDPVTITKDNASIVAKTLQITDKGRVITFEGNVRMNVDPSTIHKQGT"
     MLDTLKNNGH AAYSGSGKNA YGDALFHSAR VRRLKILLPV AALIVAASLT AVALVSIYLP        60
     ENIKMEGAKI ENGKVVMEKP AISGRNSDGI NYSMLAERAL QDIRNPDLIT LETIKAAVPM       120
     NDGLIARVVA STADYNRATD NLHMTAPFTL VLSSGLNANF QSAQLDIKGG NMRSDDPVTI       180
     TKDNASIVAK TLQITDKGRV ITFEGNVRMN VDPSTIHKQG T                           221
//

If you have problems or comments...

PBIL Back to PBIL home page